View Post

Amyloid β Peptide (1-42), Assay Kit B including buffers

In by ian

Amyloid β Peptide (1-42) peptide assay kit with scrambled sequence (1-42scr) for control. Assay kit containing  Biopure amyloid β peptide (1-42) and  control scrambled sequence (1-42scr) peptide. Also includes amyloid buffer pack …

View Post

Amyloid Buffer Pack

In by ian

  Buffer pack includes the most commonly used buffers for dissolving and assaying amyloid peptides. Includes the following buffers: 1×0.5 mL 10mM NaOH 1×0.5 mL 1% NH4OH 1×0.5 mL HFIP …

View Post

Brazzein, 1-54

In by ian

SEQUENCE:  QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

UniProt ID: P56552

Purity: >99%

DATA SHEET

View Post

Brazzein, 2-54

In by ian

Sequence: DKCKKVYEN YPVSKCQLAN QCNYDCKLDK HARSGECFYD EKRNLQCICD YCEY
Purity: >99%
Counterion: Ammonium bicarbonate
View Post

Proinsulin, Human

In by ian

Sequence:  FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
UniProt ID: P01308
Purity: >99% Counterion: Ammonium bicarbonate
For orders greater than 1000 micrograms (ug) please Request A Quote.