Incorporate both dNTPs and standard NTPs into RNA transcripts with this mutated T7 RNA polymerase
AmideBio Awarded SBIR Phase IIB Grant to Support Pre-Clinical Development of its Long- Acting Stable Glucagon Analog for the Treatment of Hyperinsulinism
BOULDER, CO, October 4th, 2022 – AmideBio, LLC, a privately held biopharmaceutical company, announced today that it has received $2.69M in funding through a Phase IIB Small Business Innovation Research …
FCOI Policy
This Financial Conflict of Interest Policy (this “Policy”) describes certain legal obligations applicable to Investigators’ disclosure of potential financial conflicts of interest (“FCOI”). The purpose of this policy is to …
Dr. Mikhail (Misha) Plam, AmideBio Co-founder, Obituary (December 1, 1936-February 21, 2022)
https://www.legacy.com/us/obituaries/dailycamera/name/mikhail-plam-obituary?id=33261146
Bowman-Birk Inhibitor, Lentil Bean (Lens culinaris)
Sequence: GDDVKSACCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTHKFCYKACHNSEIEE
Purity: >99%
Amyloid β Peptide (1-40), Assay Kit C including buffers
Amyloid β Peptide (1-40) peptide assay kit with scrambled sequence (1-40scr) for control. Assay kit containing Biopure amyloid β peptide (1-40) and control scrambled sequence (1-40scr) peptide. Also includes amyloid …
Amyloid Buffer Pack
Buffer pack includes the most commonly used buffers for dissolving and assaying amyloid peptides. Includes the following buffers: 1×0.5 mL 10mM NaOH 1×0.5 mL 1% NH4OH 1×0.5 mL HFIP …
Amyloid β Peptide (1-42), Assay Kit B including buffers
Amyloid β Peptide (1-42) peptide assay kit with scrambled sequence (1-42scr) for control. Assay kit containing Biopure amyloid β peptide (1-42) and control scrambled sequence (1-42scr) peptide. Also includes amyloid buffer pack …
Amyloid β Peptide (1-42), Assay Kit A including buffers
Amyloid β Peptide (1-42) peptide assay kit with reverse sequence (42-1) for control. Assay kit containing Biopure amyloid β peptide (1-42) and control reverse (42-1) peptide. Also includes amyloid buffer …