Amyloid β Peptide (1-40), Human

$60.00$250.00

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Purity: >99% Counterion:NH4-Formate

DATA SHEET

SKU: AA-002 Category:

Description

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.