Amyloid β Peptide (1-42) Scrambled, Human
Price range: $135.00 through $480.00
Sequence: KVKGLIDGDHIGDLVYEFMDSNSAIFREGVGAGHVHVAQVEF
Purity: >99% Counterion: Ammonium bicarbonate
Description
Scrambled amyloid β peptide (1-42) is amyloid β (1-42) with scrambled sequence. It therefore has the same amino acid composition but different sequence and is often used as a control peptide. Beta amyloid (1-42) is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain.


