Amyloid β Peptide (42-1), Human

$100.00$350.00

Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Purity: >99% Counterion: Ammonium bicarbonate

DATA SHEET

SKU: AA-003 Category:

Description

Beta amyloid (42-1) is the reverse of beta amyloid (1-42) and is used as a control peptide. Beta amyloid (1-42) is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain.