Amyloid β Peptide (40-1), Human

$100.00$350.00

Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Purity: >99% Counterion: Ammonium bicarbonate

DATA SHEET

Clear
SKU: AA-005 Category:

Description

A reversed, inactive sequence of the Amyloid β peptide (1-40) commonly used as a control peptide. Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.